Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00004507-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00004507-M01, RRID:AB_606612
- Product name
- MTAP monoclonal antibody (M01), clone 2G4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant MTAP.
- Antigen sequence
MASGTTTTAVKIGIIGGTGLDDPEILEGRTEKYVD
TPFGKPSDALILGKIKNVDCILLARHGRQHTIMPS
KVNYQANIWALKEEGCTHVIVTTACGSLREEIQPG
DIVIIDQFIDSHVRRACFPFTFHHDCFQRPPQKPS
RSHCVSCATCRTMS- Isotype
- IgG
- Antibody clone number
- 2G4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Integrative genomics identifies molecular alterations that challenge the linear model of melanoma progression.
Rose AE, Poliseno L, Wang J, Clark M, Pearlman A, Wang G, Vega Y Saenz de Miera EC, Medicherla R, Christos PJ, Shapiro R, Pavlick A, Darvishian F, Zavadil J, Polsky D, Hernando E, Ostrer H, Osman I
Cancer research 2011 Apr 1;71(7):2561-71
Cancer research 2011 Apr 1;71(7):2561-71
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- MTAP monoclonal antibody (M01), clone 2G4 Western Blot analysis of MTAP expression in HeLa ( Cat # L013V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- MTAP monoclonal antibody (M01), clone 2G4. Western Blot analysis of MTAP expression in Raw 264.7 ( Cat # L024V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged MTAP is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to MTAP on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol