Antibody data

Product number
H00004507-M08
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00004507-M08, RRID:AB_1136962
Product name
MTAP monoclonal antibody (M08), clone 4C8
Provider product page
Abnova Corporation - H00004507-M08
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant MTAP.
Antigen sequence
MASGTTTTAVKIGIIGGTGLDDPEILEGRTEKYVD
TPFGKPSDALILGKIKNVDCILLARHGRQHTIMPS
KVNYQANIWALKEEGCTHVIVTTACGSLREEIQPG
DIVIIDQFIDRTTMRPQSFYDGSHSCARGVCHIPM
AEPFCPKTREVLIETAKKLGLRCHSKGTMVTIEGP
RFSSRAESFMFRTWGADVINMTTVPEVVLAKEAGI
CYASIAMATDYDCWKEHEEAVSVDRVLKTLKENAN
KAKSLLLTTIPQIGSTEWSETLHNLKNMAQFSVLL
PRH
Isotype
IgG
Antibody clone number
4C8
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -