Explore
Validate
Learn
Western blot
ELISAAntibody data
- Antibody Data
- Antigen structure
- References [4]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00011026-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00011026-M01, RRID:AB_425878
- Product name
- LILRA3 monoclonal antibody (M01), clone 2E9
- Antibody type
- Monoclonal
- Antigen
- LILRA3 (AAH28208.1, 1 a.a. ~ 439 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
- Reactivity
- Human
- Host
- Mouse
- Antigen sequence
MTSILTVLICLGLSLDPRTHVQAGPLPKPTLWAEP
GSVITQGSPVTLRCQGSLETQEYHLYREKKTALWI
TRIPQELVKKGQFPILSITWEHAGRYCCIYGSHTV
GLSESSDPLELVVTGAYSKPTLSALPSPVVTSGGN
VTIQCDSQVAFDGFILCKEGEDEHPQCLNSHSHAR
GSSRAIFSVGPVSPSRRWSYRCYGYDSRAPYVWSL
PSDLLGLLVPGVSKKPSLSVQPGPVVAPGEKLTFQ
CGSDAGYDRFVLYKEWGRDFLQRPGRQPQAGLSQA
NFTLGPVSRSYGGQYTCSGAYNLSSEWSAPSDPLD
ILITGQIRARPFLSVRPGPTVASGENVTLLCQSQG
GMHTFLLTKEGAADSPLRLKSKRQSHKYQAEFPMS
PVTSAHAGTYRCYGSLSSNPYLLTHPSDPLELVVS
GAAETLSPPQNKSDSKAGE- Isotype
- IgG
- Vial size
- 100 µg
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Serum Leukocyte Immunoglobulin-Like Receptor A3 (LILRA3) Is Increased in Patients with Multiple Sclerosis and Is a Strong Independent Indicator of Disease Severity; 6.7kbp LILRA3 Gene Deletion Is Not Associated with Diseases Susceptibility.
Soluble LILRA3 promotes neurite outgrowth and synapses formation through high affinity interaction with Nogo 66.
Glycosylation in a mammalian expression system is critical for the production of functionally active leukocyte immunoglobulin-like receptor A3 protein.
Soluble LILRA3, a potential natural antiinflammatory protein, is increased in patients with rheumatoid arthritis and is tightly regulated by interleukin 10, tumor necrosis factor-alpha, and interferon-gamma.
An H, Lim C, Guillemin GJ, Vollmer-Conna U, Rawlinson W, Bryant K, Tedla N
PloS one 2016;11(2):e0149200
PloS one 2016;11(2):e0149200
Soluble LILRA3 promotes neurite outgrowth and synapses formation through high affinity interaction with Nogo 66.
An H, Brettle M, Lee T, Heng B, Lim CK, Guillemin GJ, Lord MS, Klotzsch E, Geczy CL, Bryant K, Fath T, Tedla N
Journal of cell science 2016 Jan 29;
Journal of cell science 2016 Jan 29;
Glycosylation in a mammalian expression system is critical for the production of functionally active leukocyte immunoglobulin-like receptor A3 protein.
Lee TH, Mitchell A, Liu Lau S, An H, Rajeaskariah P, Wasinger V, Raftery M, Bryant K, Tedla N
The Journal of biological chemistry 2013 Nov 15;288(46):32873-85
The Journal of biological chemistry 2013 Nov 15;288(46):32873-85
Soluble LILRA3, a potential natural antiinflammatory protein, is increased in patients with rheumatoid arthritis and is tightly regulated by interleukin 10, tumor necrosis factor-alpha, and interferon-gamma.
An H, Chandra V, Piraino B, Borges L, Geczy C, McNeil HP, Bryant K, Tedla N
The Journal of rheumatology 2010 Aug 1;37(8):1596-606
The Journal of rheumatology 2010 Aug 1;37(8):1596-606
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of LILRA3 expression in transfected 293T cell line by LILRA3 monoclonal antibody (M01), clone 2E9.Lane 1: LILRA3 transfected lysate(50.485 KDa).Lane 2: Non-transfected lysate.
