Antibody data

Product number
H00011026-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00011026-B01P, RRID:AB_1576806
Product name
LILRA3 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00011026-B01P
Antibody type
Polyclonal
Antigen
LILRA3 (NP_006856.2, 1 a.a. ~ 439 a.a) full-length human protein.
Reactivity
Human
Host
Mouse
Antigen sequence
MTSILTVLICLGLSLDPRTHVQAGPLPKPTLWAEP
GSVITQGSPVTLRCQGSLETQEYHLYREKKTALWI
TRIPQELVKKGQFPILSITWEHAGRYCCIYGSHTV
GLSESSDPLELVVTGAYSKPTLSALPSPVVTSGGN
VTIQCDSQVAFDGFILCKEGEDEHPQCLNSHSHAR
GSSRAIFSVGPVSPSRRWSYRCYGYDSRAPYVWSL
PSDLLGLLVPGVSKKPSLSVQPGPVVAPGEKLTFQ
CGSDAGYDRFVLYKEWGRDFLQRPGRQPQAGLSQA
NFTLGPVSRSYGGQYTCSGAYNLSSEWSAPSDPLD
ILITGQIRARPFLSVRPGPTVASGENVTLLCQSQG
GMHTFLLTKEGAADSPLRLKSKRQSHKYQAEFPMS
PVTSAHAGTYRCYGSLSSNPYLLTHPSDPLELVVS
GAAETLSPPQNKSDSKAGE
Vial size
50 µg
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -