H00007490-M06

WT1 antibody from Abnova Corporation
AWT1, GUD, NPHS4, WAGR, WIT-2

Antibody data

Product number
H00007490-M06
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00007490-M06, RRID:AB_1205177
Product name
WT1 monoclonal antibody (M06), clone 1E9
Provider product page
Abnova Corporation - H00007490-M06
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant WT1.
Antigen sequence
QDVRRVPGVAPTLVRSASETSEKRPFMCAYPGCNK
RYFKLSHLQMHSRKHTGEKPYQCDFKDCERRFSRS
DQLKRHQRRHTGVKPFQCKTC
Isotype
IgG
Antibody clone number
1E9
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -