Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [8]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA049326 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA049326, RRID:AB_2680714
- Product name
- Anti-CAV1
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
LIEIQCISRVYSIYVHTVCDPLFEAVGKIFSNVRI
NLQKEI- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human Lung tissue
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human lung and pancreas tissues using HPA049326 antibody. Corresponding CAV1 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human lung shows strong cytoplasmic and membranous positivity in pneumocytes.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human lung shows high expression.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human pancreas shows low expression as expected.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human liver shows moderate membranous positivity in hepatic sinusoid cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human placenta shows strong membranous positivity in endothelial cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human lung shows strong membranous positivity in pneumocytes.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human pancreas shows no positivity in exocrine glandular cells as expected.
- Sample type
- HUMAN