Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN504683 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Caveolin 1, Caveolae Protein, 22kDa (CAV1) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-CAV1 antibody: synthetic peptide directed towards the N terminal of human CAV1
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Antigen sequence
SGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADEL
SEKQV YDAHTKEIDL- Vial size
- 50 μg
- Storage
- Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen. For longer periods of storage, store at -20°C
Submitted references Expression changes of CAV1 and EZH2, located on 7q31 approximately q36, are rarely related to genomic alterations in primary prostate carcinoma.
Bachmann N, Haeusler J, Luedeke M, Kuefer R, Perner S, Assum G, Paiss T, Hoegel J, Vogel W, Maier C
Cancer genetics and cytogenetics 2008 Apr 15;182(2):103-10
Cancer genetics and cytogenetics 2008 Apr 15;182(2):103-10
No comments: Submit comment
No validations: Submit validation data