H00003718-M03A

JAK3 antibody from Abnova Corporation
JAK-3, JAK3_HUMAN, JAKL, L-JAK, LJAK
No application information provided.

Antibody data

Product number
H00003718-M03A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00003718-M03A, RRID:AB_1576439
Product name
JAK3 monoclonal antibody (M03A), clone 2A5
Provider product page
Abnova Corporation - H00003718-M03A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant JAK3.
Antigen sequence
MAPPSEETPLIPQRSCSLLSTEAGALHVLLPARGP
GPPQRLSFSFGDHLAEDLCVQAAKASGILPVYHSL
FALATEDLSCWFPPSHIFSVEDASTQVLLYRIRFY
FPNWFGLEKCHRFGLRKDLASAILDLPVLEHLFAQ
HRSDLVSGRLPVGLSLKEQGECLSLAVLDLARMAR
EQAQRPGELLKTVSYKACLPPSLRDLIQGLSFVTR
RRIRRTVRRALRRVAACQADRHSLMAKYIMDLERL
DPAGAAETFHVGLPGALGGHDGLGLLRVAGDGGIA
WTQGEQEVLQPFCDFPEIVDISIKQAPRVGPAGEH
RLVTVTRTDNQILEAEFPGLPEALSFVALVDGYFR
LTTDSQHFFCKEVAPPRLLEEVAEQCHGPITLDFA
INKLKTGGSRPGSYVLRRSPQDFDSFLLTVCVQNP
LGPDYKGCLIRRSPTGTFLLVGLSRPHSSLRELLA
TCWDGGLHVDGVAVTLTSCCIPRPKEKSNLIVVQR
GHSPPTSSLVQPQSQYQLSQMTFHKIPADSLEWHE
NLGHGSFTKIYRGCRHEVVDGEARKTEVLLKVMDA
KHKNCMESFLEAASLMSQVSYRHLVLLHGVCMAGD
SESPPPTHPTPASPKSRLFFPPLF
Isotype
IgG
Antibody clone number
2A5
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -