Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN504570 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Nuclear Factor of kappa Light Polypeptide Gene Enhancer in B-Cells Inhibitor, alpha (NFKBIA) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-NFKBIA antibody: synthetic peptide directed towards the N terminal of human NFKBIA
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine
- Host
- Rabbit
- Antigen sequence
FQAAERPQEWAMEGPRDGLKKERLLDDRHDSGLDS
MKDEE YEQMVKELQE- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Pre-folding IkappaBalpha alters control of NF-kappaB signaling.
Truhlar SM, Mathes E, Cervantes CF, Ghosh G, Komives EA
Journal of molecular biology 2008 Jun 27;380(1):67-82
Journal of molecular biology 2008 Jun 27;380(1):67-82
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting