Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN184344 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Nuclear Factor of kappa Light Polypeptide Gene Enhancer in B-Cells Inhibitor, alpha (NFKBIA) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-NFKBIA antibody: synthetic peptide directed towards the N terminal of human NFKBIA
- Description
- Affinity Purified
- Reactivity
- Human, Porcine
- Host
- Rabbit
- Antigen sequence
MFQAAERPQEWAMEGPRDGLKKERLLDDRHDSGLD
SMKDE EYEQMVKELQ- Vial size
- 50 μg
- Storage
- Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen. For longer periods of storage, store at -20°C
Submitted references The same IkappaBalpha mutation in two related individuals leads to completely different clinical syndromes.
Janssen R, van Wengen A, Hoeve MA, ten Dam M, van der Burg M, van Dongen J, van de Vosse E, van Tol M, Bredius R, Ottenhoff TH, Weemaes C, van Dissel JT, Lankester A
The Journal of experimental medicine 2004 Sep 6;200(5):559-68
The Journal of experimental medicine 2004 Sep 6;200(5):559-68
No comments: Submit comment
No validations: Submit validation data