Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00006773-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00006773-M01, RRID:AB_566206
- Product name
- STAT2 monoclonal antibody (M01), clone 5G7
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant STAT2.
- Antigen sequence
KAGLDLGPELESVLESTLEPVIEPTLCMVSQTVPE
PDQGPVSQPVPEPDLPCDLRHLNTEPMEIFRNCVK
IEEIMPNGDPLLAGQNTVDEVYVSRPSHFYTDGPL
MPSDF- Isotype
- IgG
- Antibody clone number
- 5G7
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- STAT2 monoclonal antibody (M01), clone 5G7 Western Blot analysis of STAT2 expression in A-431 ( Cat # L015V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged STAT2 is 0.03 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to STAT2 on A-431 cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol