HPA018888

STAT2 antibody from Sigma-Aldrich
STAT113
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018888
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018888, RRID:AB_1857550
Product name
Anti-STAT2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018888
Antibody type
Polyclonal
Antigen
Signal transducer and activator of transcription 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DPTQLAEMIFNLLLEEKRILIQAQRAQLEQGEPVL
ETPVESQQHEIESRILDLRAMMEKLVKSISQLKDQ
QDVFCFRYKIQAKGKTPSLDPHQTKEQKILQETLN
ELDKRRKEVLDASKALLGRLTTLIELLLPKL
Storage
-20C
Provider Type Product Number
- No reagents -