HPA022953

ACLY antibody from Sigma-Aldrich
ACL, ATPCL, CLATP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA022953
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA022953, RRID:AB_1844514
Product name
Anti-ACLY antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA022953
Antibody type
Polyclonal
Antigen
ATP-citrate synthase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
CANQASETAVAKNQALKEAGVFVPRSFDELGEIIQ
SVYEDLVANGVIVPAQEVPPPTVPMDYSWARELGL
IRKPASFMTSICDERGQELIYAGMPITE
Storage
-20C
Provider Type Product Number
- No reagents -