HPA000697

PIR antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000697
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000697, RRID:AB_1079621
Product name
Anti-PIR antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000697
Antibody type
Polyclonal
Antigen
Pirin recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TVSYLLEGGSMAHEDFCGHTGKMNPGDLQWMTAGR
GILHAEMPCSEEPAHGLQLWVNLRSSEKMVEPQYQ
ELKSEEIPKPSKDGVTVAVISGEALGIKSKVYTRT
PTLYLDF
Storage
-20C
Provider Type Product Number
- No reagents -