HPA016429

BAG5 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA016429
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA016429, RRID:AB_1845261
Product name
Anti-BAG5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA016429
Antibody type
Polyclonal
Antigen
BAG family molecular chaperone regulator 5 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
INKLLKYLDLEEEADTTKAFDLRQNHSILKIEKVL
KRMREIKNELLQAQNPSELYLSSKTELQGLIGQLD
EVSLEKNPCIREARRRAVIEVQTLITYIDLKEALE
KRKLFACEEHPSHKAVWNVLGNLSEIQGEVLSFDG
NRTDKNYIRLE
Storage
-20C
Provider Type Product Number
- No reagents -