HPA001012

ARHGAP4 antibody from Atlas Antibodies
C1, KIAA0131, p115, RhoGAP4, SrGAP4
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA001012
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA001012, RRID:AB_611315
Product name
Anti-ARHGAP4
Provider product page
Atlas Antibodies - HPA001012
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
EHNGMRGLIPHKYITLPAGTEKQVVGAGLQTAGES
GSSPEGLLASELVHRPEPCTSPEAMGPSGHRRRCL
VPASPEQHVEVDKAVAQNMDSVFKELLGKTSVRQG
LGPASTTSP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -