HPA001012

ARHGAP4 antibody from Sigma-Aldrich
C1, KIAA0131, p115, RhoGAP4, SrGAP4
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001012
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001012, RRID:AB_1078201
Product name
Anti-ARHGAP4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001012
Antibody type
Polyclonal
Antigen
ρ-GTPase-activating protein 4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EHNGMRGLIPHKYITLPAGTEKQVVGAGLQTAGES
GSSPEGLLASELVHRPEPCTSPEAMGPSGHRRRCL
VPASPEQHVEVDKAVAQNMDSVFKELLGKTSVRQG
LGPASTTSP
Storage
-20C
Provider Type Product Number
- No reagents -