H00139596-B01P

UPRT antibody from Abnova Corporation
DKFZp781E1243, FUR1, MGC23937, RP11-311P8.3

Antibody data

Product number
H00139596-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00139596-B01P, RRID:AB_10713327
Product name
UPRT purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00139596-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human UPRT protein.
Antigen sequence
MATELQCPDSMPCHNQQVNSASTPSPEQLRPGDLI
LDHAGGNRASRAKVILLTGYAHSSLPAELDSGACG
GSSLNSEGNSGSGDSSSYDAPAGNSFLEDCELSRQ
IGAQLKLLPMNDQIRELQTIIRDKTASRGDFMFSA
DRLIRLVVEEGLNQLPYKECMVTTPTGYKYEGVKF
EKGNCGVSIMRSGEAMEQGLRDCCRSIRIGKILIQ
SDEETQRAKVYYAKFPPDIYRRKVLLMYPILSTGN
TVIEAVKVLIEHGVQPSVIILLSLFSTPHGAKSII
QEFPEITILTTEVHPVAPTHFGQKYFGTD
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -