HPA000805

UPRT antibody from Atlas Antibodies
DKFZp781E1243, FUR1, MGC23937, RP11-311P8.3
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA000805
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA000805, RRID:AB_1080482
Product name
Anti-UPRT
Provider product page
Atlas Antibodies - HPA000805
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
TGYKYEGVKFEKGNCGVSIMRSGEAMEQGLRDCCR
SIRIGKILIQSDEETQRAKVYYAKFPPDIYRRKVL
LMYPILSTGNTVIEAVKVLIEHGVQPSVIILLSLF
STPHGAKSIIQEFPEIT
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -