HPA000805

UPRT antibody from Sigma-Aldrich
DKFZp781E1243, FUR1, MGC23937, RP11-311P8.3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000805
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000805, RRID:AB_1080482
Product name
Anti-UPRT antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000805
Antibody type
Polyclonal
Antigen
Protein FLJ31792 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TGYKYEGVKFEKGNCGVSIMRSGEAMEQGLRDCCR
SIRIGKILIQSDEETQRAKVYYAKFPPDIYRRKVL
LMYPILSTGNTVIEAVKVLIEHGVQPSVIILLSLF
STPHGAKSIIQEFPEIT
Storage
-20C
Provider Type Product Number
- No reagents -