H00001676-M05

DFFA antibody from Abnova Corporation
DFF-45, DFF1, DFF45, ICAD

Antibody data

Product number
H00001676-M05
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00001676-M05, RRID:AB_1237687
Product name
DFFA monoclonal antibody (M05), clone 3A11
Provider product page
Abnova Corporation - H00001676-M05
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant DFFA.
Antigen sequence
TSSDVALASHILTALREKQAPELSLSSQDLELVTK
EDPKALAVALNWDIKKTETVQEACERELALRLQQT
QSLHSLRSISASKASPPGDLQNPKRARQDPT
Isotype
IgG
Antibody clone number
3A11
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -