Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Proximity ligation assay [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00001676-M05 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00001676-M05, RRID:AB_1237687
- Product name
- DFFA monoclonal antibody (M05), clone 3A11
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant DFFA.
- Antigen sequence
TSSDVALASHILTALREKQAPELSLSSQDLELVTK
EDPKALAVALNWDIKKTETVQEACERELALRLQQT
QSLHSLRSISASKASPPGDLQNPKRARQDPT- Isotype
- IgG
- Antibody clone number
- 3A11
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of DFFA expression in transfected 293T cell line by DFFA monoclonal antibody (M05), clone 3A11.Lane 1: DFFA transfected lysate (Predicted MW: 36.5 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged DFFA is 0.1 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Proximity Ligation Analysis of protein-protein interactions between CASP3 and DFFA. HeLa cells were stained with anti-CASP3 rabbit purified polyclonal 1:1200 and anti-DFFA mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
- Validation comment
- In situ Proximity Ligation Assay (Cell)