HPA018859

DFFA antibody from Sigma-Aldrich
DFF-45, DFF1, DFF45, ICAD
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018859
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018859, RRID:AB_1847622
Product name
Anti-DFFA antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018859
Antibody type
Polyclonal
Antigen
DNA fragmentation factor subunit alpha recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MEVTGDAGVPESGEIRTLKPCLLRRNYSREQHGVA
ASCLEDLRSKACDILAIDKSLTPVTLVLAEDGTIV
DDDDYFLCLP
Storage
-20C
Provider Type Product Number
- No reagents -