HPA027280

ABL1 antibody from Atlas Antibodies
ABL, c-ABL, JTK7, p150
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA027280
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA027280, RRID:AB_1844454
Product name
Anti-ABL1
Provider product page
Atlas Antibodies - HPA027280
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
TEWRSVTLPRDLQSTGRQFDSSTFGGHKSEKPALP
RKRAGENRSDQVTRGTVTPPPRLVKKNEEAADEVF
KDIMESSP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -