HPA027280

ABL1 antibody from Sigma-Aldrich
ABL, c-ABL, JTK7, p150
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027280
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027280, RRID:AB_1844454
Product name
Anti-ABL1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027280
Antibody type
Polyclonal
Antigen
Proto-oncogene tyrosine-protein kinase ABL1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TEWRSVTLPRDLQSTGRQFDSSTFGGHKSEKPALP
RKRAGENRSDQVTRGTVTPPPRLVKKNEEAADEVF
KDIMESSP
Storage
-20C
Provider Type Product Number
- No reagents -