HPA000916

NKAP antibody from Sigma-Aldrich
FLJ22626
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000916
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000916, RRID:AB_1079486
Product name
Anti-NKAP antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000916
Antibody type
Polyclonal
Antigen
NF-kappa-B-activating protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RRRSSSKSPKPSKSARSPRGRRSRSHSCSRSGDRN
GLTHQLGGLSQGSRNQSYRSRSRSRSRERPSAPRG
IPFASASSSVYYGSYSRPYGSDKPWPSLLDKEREE
SLRQKRLS
Storage
-20C
Provider Type Product Number
- No reagents -