Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [3]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00006804-M02 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00006804-M02, RRID:AB_607119
- Product name
- STX1A monoclonal antibody (M02), clone 1B11-1A8
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant STX1A.
- Antigen sequence
MKDRTQELRTAKDSDDDDDVAVTVDRDRFMDEFFE
QVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEK
TKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEG
LNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSD
YRERCKGRIQRQLEITGRTTTSEELEDMLESGNPA
IFASGIIMDSSISKQALSEIETRHSEIIKLENSIR
ELHDMFMDMAMLVESQTMWRGPCLTPRRPSSTRAR
RAGRKS- Isotype
- IgG
- Antibody clone number
- 1B11-1A8
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- STX1A monoclonal antibody (M02), clone 1B11-1A8 Western Blot analysis of STX1A expression in IMR-32 ( Cat # L008V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of STX1A expression in transfected 293T cell line by STX1A monoclonal antibody (M02), clone 1B11-1A8.Lane 1: STX1A transfected lysate(29 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- STX1A monoclonal antibody (M02), clone 1B11-1A8. Western Blot analysis of STX1A expression in PC-12(Cat # L012V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged STX1A is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to STX1A on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol