HPA022040

RUNX2 antibody from Atlas Antibodies
AML3, CBFA1, CCD, CCD1, PEBP2A1, PEBP2aA1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA022040
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA022040, RRID:AB_1846086
Product name
Anti-RUNX2
Provider product page
Atlas Antibodies - HPA022040
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LNSAPSPFNPQGQSQITDPRQAQSSPPWSYDQSYP
SYLSQMTSPSIHSTTPLSSTRGTGLPAITDVPRRI
SGASELGPFSDPRQFPSISSLTESRFSNPRMHYPA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -