Explore
Validate
LearnH00000860-M06
antibody from Abnova Corporation
Targeting: RUNX2
AML3, CBFA1, CCD, CCD1, PEBP2A1, PEBP2aA1
ELISAAntibody data
- Antibody Data
- Antigen structure
- References [4]
- Comments [0]
- Validations
- ELISA [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000860-M06 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00000860-M06, RRID:AB_606971
- Product name
- RUNX2 monoclonal antibody (M06), clone 3F5
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant RUNX2.
- Antigen sequence
NPRPSLNSAPSPFNPQGQSQITDPRQAQSSPPWSY
DQSYPSYLSQMTSPSIHSTTPLSSTRGTGLPAITD
VPRRISDDDTATSDFCLWPSTLSKKSQAGA- Isotype
- IgG
- Antibody clone number
- 3F5
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Aggregatibacter actinomycetemcomitans lipopolysaccharide regulates bone sialoprotein gene transcription.
Transcription factor Runx2 is a regulator of epithelial-mesenchymal transition and invasion in thyroid carcinomas.
cAMP and fibroblast growth factor 2 regulate bone sialoprotein gene expression in human prostate cancer cells.
Effects of inorganic polyphosphate on bone sialoprotein gene expression.
Li X, Zhou L, Takai H, Sasaki Y, Mezawa M, Li Z, Wang Z, Yang L, Wang S, Matsumura H, Kaneko T, Yoshimura A, Ogata Y
Journal of cellular biochemistry 2012 Sep;113(9):2822-34
Journal of cellular biochemistry 2012 Sep;113(9):2822-34
Transcription factor Runx2 is a regulator of epithelial-mesenchymal transition and invasion in thyroid carcinomas.
Niu DF, Kondo T, Nakazawa T, Oishi N, Kawasaki T, Mochizuki K, Yamane T, Katoh R
Laboratory investigation; a journal of technical methods and pathology 2012 Aug;92(8):1181-90
Laboratory investigation; a journal of technical methods and pathology 2012 Aug;92(8):1181-90
cAMP and fibroblast growth factor 2 regulate bone sialoprotein gene expression in human prostate cancer cells.
Li Z, Sasaki Y, Mezawa M, Wang S, Li X, Yang L, Wang Z, Zhou L, Araki S, Matsumura H, Takai H, Ogata Y
Gene 2011 Jan 15;471(1-2):1-12
Gene 2011 Jan 15;471(1-2):1-12
Effects of inorganic polyphosphate on bone sialoprotein gene expression.
Wang Z, Li X, Li Z, Yang L, Sasaki Y, Wang S, Zhou L, Araki S, Mezawa M, Takai H, Ogata Y
Gene 2010 Mar 1;452(2):79-86
Gene 2010 Mar 1;452(2):79-86
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged RUNX2 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to RUNX2 on U-2 OS cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to RUNX2 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol
