H00000860-M01
antibody from Abnova Corporation
Targeting: RUNX2
AML3, CBFA1, CCD, CCD1, PEBP2A1, PEBP2aA1
Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000860-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00000860-M01, RRID:AB_529978
- Product name
- RUNX2 monoclonal antibody (M01), clone 1D8
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant RUNX2.
- Antigen sequence
NPRPSLNSAPSPFNPQGQSQITDPRQAQSSPPWSY
DQSYPSYLSQMTSPSIHSTTPLSSTRGTGLPAITD
VPRRISDDDTATSDFCLWPSTLSKKSQAGA- Isotype
- IgG
- Antibody clone number
- 1D8
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Processing large-diameter poly(L-lactic acid) microfiber mesh/mesenchymal stromal cell constructs via resin embedding: an efficient histologic method.
Runt-related transcription factor 2 in human colon carcinoma: a potent prognostic factor associated with estrogen receptor.
D'Alessandro D, Pertici G, Moscato S, Metelli MR, Danti S, Nesti C, Berrettini S, Petrini M, Danti S
Biomedical materials (Bristol, England) 2014 Aug;9(4):045007
Biomedical materials (Bristol, England) 2014 Aug;9(4):045007
Runt-related transcription factor 2 in human colon carcinoma: a potent prognostic factor associated with estrogen receptor.
Sase T, Suzuki T, Miura K, Shiiba K, Sato I, Nakamura Y, Takagi K, Onodera Y, Miki Y, Watanabe M, Ishida K, Ohnuma S, Sasaki H, Sato R, Karasawa H, Shibata C, Unno M, Sasaki I, Sasano H
International journal of cancer 2012 Nov 15;131(10):2284-93
International journal of cancer 2012 Nov 15;131(10):2284-93
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of RUNX2 expression in transfected 293T cell line by RUNX2 monoclonal antibody (M01), clone 1D8.Lane 1: RUNX2 transfected lysate (Predicted MW: 60.28 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- RUNX2 monoclonal antibody (M01), clone 1D8. Western Blot analysis of RUNX2 expression in Jurkat.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged RUNX2 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to RUNX2 on U-2 OS cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to RUNX2 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol