HPA022040

RUNX2 antibody from Sigma-Aldrich
AML3, CBFA1, CCD, CCD1, PEBP2A1, PEBP2aA1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA022040
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA022040, RRID:AB_1846086
Product name
Anti-RUNX2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA022040
Antibody type
Polyclonal
Antigen
Runt-related transcription factor 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LNSAPSPFNPQGQSQITDPRQAQSSPPWSYDQSYP
SYLSQMTSPSIHSTTPLSSTRGTGLPAITDVPRRI
SGASELGPFSDPRQFPSISSLTESRFSNPRMHYPA
Storage
-20C
Provider Type Product Number
- No reagents -