Antibody data

Product number
H00064743-M03
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00064743-M03, RRID:AB_1581906
Product name
WDR13 monoclonal antibody (M03), clone 1G9
Provider product page
Abnova Corporation - H00064743-M03
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant WDR13.
Antigen sequence
GTLQLKRSFPIEQSSHPVRSIFCPLMSFRQGACVV
TGSEDMCVHFFDVERAAKAAVNKLQGHSAPVLDVS
FNCDESLLASSDASGMVIVWRREQ
Isotype
IgG
Antibody clone number
1G9
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -