HPA026494

CD59 antibody from Atlas Antibodies
16.3A5, EJ16, EJ30, EL32, G344, MIC11, MIN1, MIN2, MIN3, MSK21, p18-20
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA026494
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA026494, RRID:AB_1846321
Product name
Anti-CD59
Provider product page
Atlas Antibodies - HPA026494
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
CYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYN
KCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFN
EQLENGG
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -