HPA026494

CD59 antibody from Sigma-Aldrich
16.3A5, EJ16, EJ30, EL32, G344, MIC11, MIN1, MIN2, MIN3, MSK21, p18-20
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026494
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA026494, RRID:AB_1846321
Product name
Anti-CD59 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA026494
Antibody type
Polyclonal
Antigen
CD59 glycoprotein Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
CYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYN
KCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFN
EQLENGG
Storage
-20C
Provider Type Product Number
- No reagents -