Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN486959 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Checkpoint Kinase 1 (CHEK1) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-CHEK1 antibody: synthetic peptide directed towards the middle region of human CHEK1
- Reactivity
- Human, Mouse, Rat, Bovine, Chicken/Avian, Xenopus
- Host
- Rabbit
- Antigen sequence
SARITIPDIKKDRWYNKPLKKGAKRPRVTSGGVSE
SPSGF SKHIQSNLDF- Vial size
- 50 µg
Submitted references Claspin is phosphorylated in the Chk1-binding domain by a kinase distinct from Chk1.
Bennett LN, Larkin C, Gillespie DA, Clarke PR
Biochemical and biophysical research communications 2008 May 9;369(3):973-6
Biochemical and biophysical research communications 2008 May 9;369(3):973-6
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Lanes: Lane 1:441 μg SH-SY5Y lysate Lane 2: 041 μg SH-SY5Y lysate ane 3: 041 μg HEK293T lysate Primary Antibody Dilution: 1:0000Secondary Antibody: Anti-rabbit-HRP Secondary Antibody Dilution: 1:0000 Gene Name: CHEK1 Submitted by: Anonymous
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Host: Rabbit Target Name: CHEK1 Sample Tissue: Human Adult Placenta Antibody Dilution: 1.0 μg/mL