Antibody data

Product number
HPA000888
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA000888, RRID:AB_1078420
Product name
Anti-CCDC22
Provider product page
Atlas Antibodies - HPA000888
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
YQNFLYPSEPDLRDLLLFLAERLPTDASEDADQPA
GDSAILLRAIGSQIRDQLALPWVPPHLRTPKLQHL
QGSALQKPFHASRLVVPELSSRGEPREFQASPLLL
PVPTQVPQPVGRVA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.