HPA000888

CCDC22 antibody from Sigma-Aldrich
CXorf37, JM1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000888
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000888, RRID:AB_1078420
Product name
Anti-CCDC22 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000888
Antibody type
Polyclonal
Antigen
Coiled-coil domain-containing protein 22 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YQNFLYPSEPDLRDLLLFLAERLPTDASEDADQPA
GDSAILLRAIGSQIRDQLALPWVPPHLRTPKLQHL
QGSALQKPFHASRLVVPELSSRGEPREFQASPLLL
PVPTQVPQPVGRVA
Storage
-20C
Provider Type Product Number
- No reagents -