HPA021816

NUP88 antibody from Sigma-Aldrich
MGC8530
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021816
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021816, RRID:AB_1854725
Product name
Anti-NUP88 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021816
Antibody type
Polyclonal
Antigen
Nuclear pore complex protein Nup88 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QLLTRNVVFGLGGELFLWDGEDSSFLVVRLRGPSG
GGEEPALSQYQRLLCINPPLFEIYQVLLSPTQHHV
ALIGIKGLMVLELPKRWGKNSEFEGGKSTVNCSTT
PVAERFFTSSTSLTLKHAAWYPSEILDPHVV
Storage
-20C
Provider Type Product Number
- No reagents -