H00000677-M02
antibody from Abnova Corporation
Targeting: ZFP36L1
Berg36, BRF1, cMG1, ERF1, RNF162B, TIS11B
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000677-M02 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00000677-M02, RRID:AB_566275
- Product name
- ZFP36L1 monoclonal antibody (M02), clone 1A3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant ZFP36L1.
- Antigen sequence
MTTTLVSATIFDLSEVLCKGNKMLNYSAPSAGGCL
LDRKAVGTPAGGGFPRRHSVTLPSSKFHQNQLLSS
LKGEPAPALSSRDSRFRDRSFSEGGERLLPTQKQP
GGG- Isotype
- IgG
- Antibody clone number
- 1A3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of ZFP36L1 expression in transfected 293T cell line by ZFP36L1 monoclonal antibody (M02), clone 1A3.Lane 1: ZFP36L1 transfected lysate(36.3 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged ZFP36L1 is approximately 1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol