HPA001301

ZFP36L1 antibody from Sigma-Aldrich
Berg36, BRF1, cMG1, ERF1, RNF162B, TIS11B
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001301
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001301, RRID:AB_1080644
Product name
Anti-ZFP36L1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001301
Antibody type
Polyclonal
Antigen
Butyrate response factor 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PRCHFIHNAEERRALAGARDLSADRPRLQHSFSFA
GFPSAAATAAATGLLDSPTSITPPPILSADDLLGS
PTLPDGTNNPFAFSSQELASLFAPSMGLPGGGSPT
TFLFRPMSESPHMFDSPPSPQDSLSDQEGYLSSSS
SSHSGSDSPT
Storage
-20C
Provider Type Product Number
- No reagents -