HPA001066

KCND1 antibody from Sigma-Aldrich
Kv4.1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001066
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001066, RRID:AB_1079662
Product name
Anti-KCND1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001066
Antibody type
Polyclonal
Antigen
Potassium voltage-gated channel subfamily D member 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NTLDRYPDTLLGSSEKEFFYDADSGEYFFDRDPDM
FRHVLNFYRTGRLHCPRQECIQAFDEELAFYGLVP
ELVGDCCLEEYRDRKKENAERLAEDEEAEQ
Storage
-20C
Provider Type Product Number
- No reagents -