Antibody data

Product number
H00004089-M01A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00004089-M01A, RRID:AB_1580050
Product name
SMAD4 monoclonal antibody (M01A), clone 3B9
Provider product page
Abnova Corporation - H00004089-M01A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant SMAD4.
Antigen sequence
MDNMSITNTPTSNDACLSIVHSLMCHRQGGESETF
AKRAIESLVKKLKEKKDELDSLITAITTSGAHPSK
CVTIQRTLDGRLQVAGRKGFPHVIYARLWRWPDLH
KNELKHVKYCQYAFDLKCDSVCVNPYHYERVVSPG
IDLSGLTLQSNAPSSMMVKDEYVHDFEGQPSLSTE
GHSIQTIQHPPSNRASTETYSTPALLAPSESNATS
TANFPNIPVASTSQPASILGGSHSEGLLQIASGPQ
PGQQQNGFTGQPATYHHNSTTTWTGSRTAPYTPNL
PHHQNGHLQHHPPMPPHPGHYWPVHNELAFQPPIS
NHPAPEYWCSIAYFEMDVQVGETFKVPSSCPIVTV
DGYVDPSGGDRFCLGQLSNVHRTEAIERARLHIGK
GVQLECKGEGDVWVRCLSDHAVFVQSYYLDREAGR
APGDAVHKIYPSAYIKVFDLRQCHRQMQQQAATAQ
AAAAAQAAAVAGNIPGPGSVGGIAPAISLSAAAGI
GVDDLRRLCILRMSFVKGWGPDYPRQSIKETPCWI
EIHLHRALQLLDEVLHTMPIADPQPLD
Isotype
IgG
Antibody clone number
3B9
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -