HPA019154

SMAD4 antibody from Sigma-Aldrich
DPC4, MADH4
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019154
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019154, RRID:AB_1853480
Product name
Anti-SMAD4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019154
Antibody type
Polyclonal
Antigen
Mothers against decapentaplegic homolog 4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AFDLKCDSVCVNPYHYERVVSPGIDLSGLTLQSNA
PSSMMVKDEYVHDFEGQPSLSTEGHSIQTIQHPPS
NRASTETYSTPALLAPSESNATSTANFPNIPVAST
SQPASILGGSHSEGLLQI
Storage
-20C
Provider Type Product Number
- No reagents -