Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [5]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA030562 - Provider product page
- Provider
- Atlas Antibodies
- Product name
- Anti-CDH5
- Antibody type
- Polyclonal
- Antigen
- Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
FTIETNPAHNEGIIKPMKPLDYEYIQQYSFIVEAT
DPTIDLRYMSPPAGNRAQVIINITDVDEPPIFQQP
FYHFQLKENQKKPLIGTVLAMDPDAARHSIGYSIR
RTSDKGQFFRVTKKGDIYNEKELDREVYPWYNLTV
EAKELDST- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage (1-2 days). Long time storage is recommended at -20°C. If stored at lower temperature, aliquot to avoid repeated freezing and thawing. Working dilution samples should be discarded if not used within 12 hours.
Submitted references Somatic GNAQ Mutation is Enriched in Brain Endothelial Cells in Sturge–Weber Syndrome
Elevated levels of circulating CDH5 and FABP1 in association with human drug‐induced liver injury
Elevated levels of FN1 and CCL2 in bronchoalveolar lavage fluid from sarcoidosis patients
Infantile hemangioma-derived stem cells and endothelial cells are inhibited by class 3 semaphorins
Hypoxia-induced expression of VE-cadherin and filamin B in glioma cell cultures and pseudopalisade structures
Huang L, Couto J, Pinto A, Alexandrescu S, Madsen J, Greene A, Sahin M, Bischoff J
Pediatric Neurology 2017;67
Pediatric Neurology 2017;67
Elevated levels of circulating CDH5 and FABP1 in association with human drug‐induced liver injury
Mikus M, Drobin K, Gry M, Bachmann J, Lindberg J, Yimer G, Aklillu E, Makonnen E, Aderaye G, Roach J, Fier I, Kampf C, Göpfert J, Perazzo H, Poynard T, Stephens C, Andrade R, Lucena M, Arber N, Uhlén M, Watkins P, Schwenk J, Nilsson P, Schuppe‐Koistinen I
Liver International 2016;37(1):132-140
Liver International 2016;37(1):132-140
Elevated levels of FN1 and CCL2 in bronchoalveolar lavage fluid from sarcoidosis patients
Hamsten C, Wiklundh E, Grönlund H, Schwenk J, Uhlén M, Eklund A, Nilsson P, Grunewald J, Häggmark-Månberg A
Respiratory Research 2016;17(1)
Respiratory Research 2016;17(1)
Infantile hemangioma-derived stem cells and endothelial cells are inhibited by class 3 semaphorins
Nakayama H, Huang L, Kelly R, Oudenaarden C, Dagher A, Hofmann N, Moses M, Bischoff J, Klagsbrun M
Biochemical and Biophysical Research Communications 2015;464(1):126-132
Biochemical and Biophysical Research Communications 2015;464(1):126-132
Hypoxia-induced expression of VE-cadherin and filamin B in glioma cell cultures and pseudopalisade structures
Nissou M, El Atifi M, Guttin A, Godfraind C, Salon C, Garcion E, van der Sanden B, Issartel J, Berger F, Wion D
Journal of Neuro-Oncology 2013;113(2):239-249
Journal of Neuro-Oncology 2013;113(2):239-249
No comments: Submit comment
No validations: Submit validation data