Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [3]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00001003-A01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00001003-A01, RRID:AB_462409
- Product name
- CDH5 polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant CDH5.
- Antigen sequence
WNQMHIDEEKNTSLPHHVGKIKSSVSRKNAKYLLK
GEYVGKVFRVDAETGDVFAIERLDRENISEYHLTA
VIVDKDTGENLETPSSFTIKVHDVNDNWPV- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- CDH5 polyclonal antibody (A01), Lot # 051003JCO1 Western Blot analysis of CDH5 expression in PC-12 ( Cat # L012V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- CDH5 polyclonal antibody (A01), Lot # ABNOVA060629QCS1. Western Blot analysis of CDH5 expression in HepG2.
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- CDH5 polyclonal antibody (A01), Lot # 051003JCO1. Western Blot analysis of CDH5 expression in Raw 264.7.