H00008743-B01P

TNFSF10 antibody from Abnova Corporation
Apo-2L, CD253, TL2, TRAIL

Antibody data

Product number
H00008743-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00008743-B01P, RRID:AB_1581473
Product name
TNFSF10 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00008743-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human TNFSF10 protein.
Antigen sequence
MAMMEVQGGPSLGQTCVLIVIFTVLLQSLCVAVTY
VYFTNELKQMQDKYSKSGIACFLKEDDSYWDPNDE
ESMNSPCWQVKWQLRQLVRKMILRTSEETISTVQE
KQQNISPLVRERGPQRVAAHITGTRGRSNTLSSPN
SKNEKALGRKINSWESSRSGHSFLSNLHLRNGELV
IHEKGFYYIYSQTYFRFQEEIKENTKNDKQMVQYI
YKYTSYPDPILLMKSARNSCWSKDAEYGLYSIYQG
GIFELKENDRIFVSVTNEHLIDMDHEASFFRGLFS
WLTDLERKSNNLKVTIQFSG
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -