H00000958-M33

CD40 antibody from Abnova Corporation
Bp50, p50, TNFRSF5

Antibody data

Product number
H00000958-M33
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00000958-M33, RRID:AB_11190155
Product name
CD40 monoclonal antibody (M33), clone 4G15
Provider product page
Abnova Corporation - H00000958-M33
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant CD40.
Antigen sequence
EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFT
ETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLR
VQQKGTSETDTICTCEEGWHCTSEACESCVLHRSC
SPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEK
CHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLR
Isotype
IgG
Antibody clone number
4G15
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -