ABIN486925

HDAC1 antibody from antibodies-online
GON-10, HD1, KDAC1, RPD3L1

Antibody data

Product number
ABIN486925
Provider
antibodies-online
Product name
anti-Histone Deacetylase 1 (HDAC1) (Middle Region) antibody
Provider product page
antibodies-online - ABIN486925
Antibody type
Polyclonal
Antigen
The immunogen for anti-HDAC1 antibody: synthetic peptide directed towards the middle region of human HDAC1
Description
Affinity Purified
Reactivity
Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus, Zebrafish
Host
Rabbit
Antigen sequence
EKIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESG
DEDED DPDKRISICS
Epitope
Middle Region
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -