Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN486798 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-BCL2-Associated Agonist of Cell Death (BAD) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-BAD antibody: synthetic peptide directed towards the C terminal of human BAD
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine
- Host
- Rabbit
- Antigen sequence
RMSDEFVDSFKKGLPRPKSAGTATQMRQSSSWTRV
FQSWW DRNLGRGSSA- Epitope
- C-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references miR-15b and miR-16 modulate multidrug resistance by targeting BCL2 in human gastric cancer cells.
Xia L, Zhang D, Du R, Pan Y, Zhao L, Sun S, Hong L, Liu J, Fan D
International journal of cancer. Journal international du cancer 2008 Jul 15;123(2):372-9
International journal of cancer. Journal international du cancer 2008 Jul 15;123(2):372-9
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting