Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Immunocytochemistry [2]
- Immunohistochemistry [8]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA055861 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA055861, RRID:AB_2682948
- Product name
- Anti-CREBBP
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
VASAETNSQQPGPDVPVLEMKTETQAEDTEPDPGE
SKGEPRSEMMEEDLQGASQVKEETDIAEQKSEPME
VDE- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
No comments: Submit comment
Enhanced validation
Supportive validation
- Submitted by
- 55af80e3e0991
- Enhanced method
- Genetic validation
- Main image
- Experimental details
- Confocal images of immunofluorescently stained human U-2 OS cells.The protein CREBBP is shown in green. The image to the left show cells transfected with control siRNA and the image to the right show cells where CREBBP has been downregulated with specific siRNA.
- Sample type
- U-2 OS cells
- Primary Ab dilution
- 1:93
- Secondary Ab
- Secondary Ab
- Secondary Ab dilution
- 1:800
- Knockdown/Genetic Approaches Application
- Immunocytochemistry
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm & nuclear bodies.
- Sample type
- HUMAN
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human endometrium and liver tissues using HPA055861 antibody. Corresponding CREBBP RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human colon shows strong nuclear positivity in glandular cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows high expression.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human liver shows low expression as expected.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human Fallopian tube shows strong nuclear positivity in glandular cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human endometrium shows strong nuclear positivity in glandular cells and stromal cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human liver shows very weak nuclear positivity in hepatocytes as expected.
- Sample type
- HUMAN