HPA062953

antibody from Atlas Antibodies

Targeting: EWSR1 EWS

Antibody data

Submit

Validation data

Product number: HPA062953 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA062953, RRID:AB_2684910
Product name: Anti-EWSR1
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: GDATVSYEDPPTAKAAVEWFDGKDFQGSKLKVSLA RKKPPMNSMRGGLPPREGRGMPPPLRGGPG
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

EWSR1 protein structure - HPA062953 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human testis and skeletal muscle tissues using Anti-EWSR1 antibody. Corresponding EWSR1 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human colon, liver, skin and testis using Anti-EWSR1 antibody HPA062953 (A) shows similar protein distribution across tissues to independent antibody HPA051771 (B).
Antibody #2 product nr: HPA051771
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon shows strong nuclear positivity in glandular cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon using Anti-EWSR1 antibody HPA062953.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skin using Anti-EWSR1 antibody HPA062953.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver using Anti-EWSR1 antibody HPA062953.
Sample type: HUMAN